Click the button below to contact us or submit your feedback about this product.
Recombinant Human FceR2 (CAT#: NITT-0425-TT9)
This Human FceR2 is a recombinant protein with a N-terminal 6xHis tag or N-terminal GST tag . It is expressed in E.coli and can be used for .
Please feel free to contact us for a quote and further discussion with our scientists. Datasheets
specifications |
|
|---|---|
| Specie Reactivity | Human |
| Target | FceR2 |
| Sequence | DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG |
| Molecule Mass | 27.3 kDa |
| Purity | > 90% as determined by SDS-PAGE |
| Endotoxin | <1.0EU/µg |
| Product Form | Lyophilized/Liquid |
| Size | 20µg; 50µg; 100µg |
| Storage | Store at 4°C for short-term and -20°C for long-term. Avoid repeated freeze-thaw cycles. |
Datasheet
KINDLY NOTE
For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.
Custom antibodies beyond the list can be tailored flexibly. Please directly Email us your specific demands.
Online Inquiry
For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.