Click the button below to contact us or submit your feedback about this product.
This product is an unconjugated anti-RAB5A Monoclonal antibody (5D1) generated from the Mouse. This antibody can be used for WB, ELISA.
Please feel free to contact us for a quote and further discussion with our scientists. Datasheets
specifications |
|
|---|---|
| Antibody Isotype | IgM, κ |
| Clone | 5D1 |
| Applications | WB; ELISA |
| Target | RAB5A |
| Host | Mouse |
| Clonality | Monoclonal |
| Antibody Type | Primary antibody |
| Species Reactivity | Human, Mouse |
| Immunogen | Recombinant human RAB5A with GST tag, aa., KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN |
| Format | Liquid |
| Buffer | Ascites |
| Storage | Store at -20° C to -80° C. Avoid freeze-thaw cycles. |
Target Information |
|
|---|---|
| Target Name | RAB5A |
| Alternative Names | RAB5A, Member RAS Oncogene Family; RAS-Associated Protein RAB5A; Ras-Related Protein Rab-5A; RAB5 |
| Related Disease | Motor Neuron Disease; Choroideremia |
| Gene ID | 5868 |
| UniProt ID | P20339 |
| Target Overview | Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Active GTP-bound form is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes. Contributes to the regulation of filopodia extension. Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan. Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3. |
Click the button below to contact us or submit your feedback about this product.
KINDLY NOTE
!! For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.
!! Custom antibodies beyond the list can be tailored flexibly. Please directly Email us your specific demands.
CONTACT US
© 2024 Creative Biolabs All Rights Reserved
Datasheet
