Click the button below to contact us or submit your feedback about this product.
This product is an unconjugated anti-Metallothionein-3 Monoclonal antibody (NIM.72T) generated from the Mouse. This antibody can be used for WB, ELISA, IF.
Please feel free to contact us for a quote and further discussion with our scientists. Datasheets
specifications |
|
|---|---|
| Antibody Isotype | IgM, κ |
| Clone | NIM.72T |
| Applications | WB; ELISA; IF |
| Target | Metallothionein-3 |
| Host | Mouse |
| Clonality | Monoclonal |
| Antibody Type | Primary antibody |
| Species Reactivity | Human, Rat |
| Immunogen | Recombinant MT3 protein with GST tag., aa., MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
| Format | Liquid |
| Buffer | Ascites |
| Storage | Store at -20° C to -80° C. Avoid freeze-thaw cycles. |
Target Information |
|
|---|---|
| Target Name | Metallothionein-3 |
| Alternative Names | GIF; Metallothionein 3 (Growth Inhibitory Factor (Neurotrophic)); Growth Inhibitory Factor; Metallothionein-III; Metallothionein-3; GIFB; MT-III; ZnMT3; GRIF; MT-3; MT3 |
| Related Disease | Milker's Nodule; Alzheimer Disease |
| Gene ID | 4504 |
| UniProt ID | P25713 |
| Target Overview | Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro. |
Click the button below to contact us or submit your feedback about this product.
For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.
Custom antibodies beyond the list can be tailored flexibly. Please directly Email us your specific demands.