Click the button below to contact us or submit your feedback about this product.
This product is an unconjugated anti-Human TIMM13 Monoclonal antibody (4F4) generated from the Mouse. This antibody can be used for WB, ELISA.
Please feel free to contact us for a quote and further discussion with our scientists. Datasheets
specifications |
|
---|---|
Antibody Isotype | IgM, κ |
Clone | 4F4 |
Applications | WB; ELISA |
Target | TIMM13 |
Host | Mouse |
Clonality | Monoclonal |
Antibody Type | Primary antibody |
Species Reactivity | Human |
Immunogen | Recombinant TIMM13 protein with GST tag, aa., MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM |
Format | Liquid |
Buffer | Ascites |
Storage | Store at -20° C to -80° C. Avoid freeze-thaw cycles. |
Target Information |
|
---|---|
Target Name | TIMM13 |
Alternative Names | Translocase of Inner Mitochondrial Membrane 13; Mitochondrial Import Inner Membrane Translocase Subunit Tim13; TIMM13A; TIMM13B; TIM13B; Translocase Of Inner Mitochondrial Membrane 13 (Yeast) Homolog B; Translocase Of Inner Mitochondrial Membrane 13 Homolog (Yeast); Mitochondrial Import Inner Membrane Translocase Subunit Tim13B; Translocase Of Inner Mitochondrial Membrane 13 Homolog; TIM13; Tim13; Ppv1 |
Related Disease | Mohr-Tranebjaerg Syndrome; Visual Cortex Disease |
Gene ID | 26517 |
UniProt ID | Q9Y5L4 |
Target Overview | Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins. |
Click the button below to contact us or submit your feedback about this product.
KINDLY NOTE
!! For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.
!! Custom antibodies beyond the list can be tailored flexibly. Please directly Email us your specific demands.
© 2024 Creative Biolabs All Rights Reserved