Click the button below to contact us or submit your feedback about this product.
This product is an unconjugated anti-Human ING1 Monoclonal antibody (NIM.84T) generated from the Mouse. This antibody can be used for WB, ELISA.
Please feel free to contact us for a quote and further discussion with our scientists. Datasheets
specifications |
|
|---|---|
| Antibody Isotype | IgM, κ |
| Clone | NIM.84T |
| Applications | WB; ELISA |
| Target | ING1 |
| Host | Mouse |
| Clonality | Monoclonal |
| Antibody Type | Primary antibody |
| Species Reactivity | Human |
| Immunogen | Recombinant human ING1 protein with GST tag, aa., DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA |
| Format | Liquid |
| Buffer | PBS, pH 7.4 |
| Storage | Store at -20° C to -80° C. Avoid freeze-thaw cycles. |
Target Information |
|
|---|---|
| Target Name | ING1 |
| Alternative Names | Inhibitor Of Growth Family Member 1; Growth Inhibitory Protein ING1; Inhibitor Of Growth Protein 1; Tumor Suppressor ING1; Growth Inhibitor ING1; P24ING1c; P33ING1b; P47ING1a; P33ING1; P33; P47Inhibitor Of Growth 1 |
| Related Disease | Squamous Cell Carcinoma Head And Neck; Squamous Cell Carcinoma |
| Gene ID | 3621 |
| UniProt ID | Q9UK53 |
| Target Overview | Cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. Implicated as a tumor suppressor gene. |
Click the button below to contact us or submit your feedback about this product.
For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.
Custom antibodies beyond the list can be tailored flexibly. Please directly Email us your specific demands.