Click the button below to contact us or submit your feedback about this product.
This product is an unconjugated anti-Coenzyme Q8A Monoclonal antibody (7G1) generated from the Mouse. This antibody can be used for WB, ELISA.
Please feel free to contact us for a quote and further discussion with our scientists. Datasheets
specifications |
|
|---|---|
| Antibody Isotype | IgM, κ |
| Clone | 7G1 |
| Applications | WB; ELISA |
| Target | Coenzyme Q8A |
| Host | Mouse |
| Clonality | Monoclonal |
| Antibody Type | Primary antibody |
| Species Reactivity | Human, Mouse, Rat |
| Immunogen | Recombinant human CABC1 protein with GST tag, aa., MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD |
| Format | Liquid |
| Buffer | Ascites |
| Storage | Store at -20° C to -80° C. Avoid freeze-thaw cycles. |
Target Information |
|
|---|---|
| Target Name | Coenzyme Q8A |
| Alternative Names | AarF Domain-Containing Protein Kinase 3; Atypical Kinase COQ8A Mitochondrial; Coenzyme Q Protein 8A; ADCK3; CABC1; SCAR9; COQ8; Chaperone, ABC1 Activity Of Bc1 Complex Homolog (S. Pombe); Chaperone, ABC1 Activity Of Bc1 Complex Like (S. Pombe); Chaperone-ABC1 (Activity Of Bc1 Complex, S.Pombe)-Like; Chaperone Activity Of Bc1 Complex-Like, Mitochondrial; Chaperone, ABC1 Activity Of Bc1 Complex Homolog; Chaperone Activity Of Bc1 Complex-Like; Atypical Kinase ADCK3 Mitochondrial; AarF Domain Containing Kinase 3; Coenzyme Q8 Homolog (Yeast); Coenzyme Q8 Homolog; Chaperone-ABC1-Like; COQ10D4; ARCA2; COQ8A |
| Related Disease | Coenzyme Q10 Deficiency Primary 4; Coenzyme Q10 Deficiency Primary 1 |
| Gene ID | 56997 |
| UniProt ID | Q8NI60 |
| Target Overview | Atypical kinase involved in the biosynthesis of coenzyme Q, also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration. Its substrate specificity is unclear: does not show any protein kinase activity. Probably acts as a small molecule kinase, possibly a lipid kinase that phosphorylates a prenyl lipid in the ubiquinone biosynthesis pathway, as suggested by its ability to bind coenzyme Q lipid intermediates. Shows an unusual selectivity for binding ADP over ATP. |
Click the button below to contact us or submit your feedback about this product.
KINDLY NOTE
!! For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.
!! Custom antibodies beyond the list can be tailored flexibly. Please directly Email us your specific demands.
© 2024 Creative Biolabs All Rights Reserved
Datasheet