Anti-Human LONRF1 (aa 1-111) IgA Monoclonal Antibody (NIA.T12) (CAT#: NGA-053)

This product is an unconjugated anti-human LONRF1 (aa 1-111) monoclonal antibody gernerated from the mouse. This antibody can be used for applications: ELISA, Western Blotting.

Please feel free to contact us for a quote and further discussion with our scientists. Datasheets

specifications

Antibody Isotype IgA, κ
Clone NIA.T12
Applications ELISA; WB
Target LONRF1
Host Mouse
Clonality Monoclonal
Antibody Type Primary antibody
Species Reactivity Human
Immunogen Partial recombinant corresponding to aa1-111 from human FLJ23749 (NP_689484) with GST tag. MW of the GST tag alone is 26kD.
MEESQSLNEPSPKQSEEIPEVTSEPVKGSLNRAQSAQSIN STEMPAREDCLKRVSSEPVLSVQEKGVLLKRKLSLLEQDV IVNEDGRNKLKKQGETPNEVCMFSLAYGDI
Format Liquid
Buffer PBS, pH 7.2
Storage Store at -20°C.

Target Information

Target Name LONRF1
Alternative Names LON Peptidase N-Terminal Domain And Ring Finger 1; RNF191; LON Peptidase N-Terminal Domain And RING Finger Protein 1; RING Finger Protein 191; FLJ23749
Related Disease Penile Benign Neoplasm
Gene ID 91694
UniProt ID Q17RB8
Target Overview LONRF1 is involved in protein binding, zinc ion binding, ATP-dependent peptidase activity and metal ion binding.
  • Customer Reviews
  • Downloadable Resources

Click the button below to contact us or submit your feedback about this product.

KINDLY NOTE

For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.

Custom antibodies beyond the list can be tailored flexibly. Please directly Email us your specific demands.



Online Inquiry
For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.
SEARCH FOR