Click the button below to contact us or submit your feedback about this product.
This product is an unconjugated anti-human LONRF1 (aa 1-111) monoclonal antibody gernerated from the mouse. This antibody can be used for applications: ELISA, Western Blotting.
Please feel free to contact us for a quote and further discussion with our scientists. Datasheets
specifications |
|
|---|---|
| Antibody Isotype | IgA, κ |
| Clone | NIA.T12 |
| Applications | ELISA; WB |
| Target | LONRF1 |
| Host | Mouse |
| Clonality | Monoclonal |
| Antibody Type | Primary antibody |
| Species Reactivity | Human |
| Immunogen | Partial recombinant corresponding to aa1-111 from human FLJ23749 (NP_689484) with GST tag. MW of the GST tag alone is 26kD. MEESQSLNEPSPKQSEEIPEVTSEPVKGSLNRAQSAQSIN STEMPAREDCLKRVSSEPVLSVQEKGVLLKRKLSLLEQDV IVNEDGRNKLKKQGETPNEVCMFSLAYGDI |
| Format | Liquid |
| Buffer | PBS, pH 7.2 |
| Storage | Store at -20°C. |
Target Information |
|
|---|---|
| Target Name | LONRF1 |
| Alternative Names | LON Peptidase N-Terminal Domain And Ring Finger 1; RNF191; LON Peptidase N-Terminal Domain And RING Finger Protein 1; RING Finger Protein 191; FLJ23749 |
| Related Disease | Penile Benign Neoplasm |
| Gene ID | 91694 |
| UniProt ID | Q17RB8 |
| Target Overview | LONRF1 is involved in protein binding, zinc ion binding, ATP-dependent peptidase activity and metal ion binding. |
Click the button below to contact us or submit your feedback about this product.
For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.
Custom antibodies beyond the list can be tailored flexibly. Please directly Email us your specific demands.