CLOSE
SEARCH FOR
Book a Meeting

Mouse Anti-Sulfatase 1 Monoclonal Antibody (1A4)

Mouse Anti-Sulfatase 1 Monoclonal Antibody (1A4) (CAT#: NGM-377)

This product is an unconjugated anti-Sulfatase 1 Monoclonal antibody (1A4) generated from the Mouse. This antibody can be used for WB, ELISA, IHC.

Please feel free to contact us for a quote and further discussion with our scientists. Datasheets

specifications
Antibody Isotype IgM, κ
Clone 1A4
Applications WB; ELISA; IHC
Target Sulfatase 1
Host Mouse
Clonality Monoclonal
Antibody Type Primary antibody
species Reactivity Human, Mouse
Immunogen Recombinant human SULF1 protein with GST tag, aa., RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Format Liquid
Buffer Ascites
Storage Store at -20° C to -80° C. Avoid freeze-thaw cycles.
Target Information
Target Name Sulfatase 1
Alternative Names Extracellular Sulfatase Sulf-1; HSulf-1; SULF-1; Sulfatase FP; SULF1
Related Disease Mesomelia-Synostoses Syndrome; Mesomelia
Gene ID 23213
UniProt ID Q8IWU6
Target Overview Exhibits arylsulfatase activity and highly specific endoglucosamine-6-sulfatase activity. It can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin. Diminishes HSPG (heparan sulfate proteoglycans) sulfation, inhibits signaling by heparin-dependent growth factors, diminishes proliferation, and facilitates apoptosis in response to exogenous stimulation.

KINDLY NOTE
!! For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.

!! Custom antibodies beyond the list can be tailored flexibly. Please directly Email us your specific demands.

Online Inquiry

For Research Use Only. Our products and services are NOT intended for diagnostic or therapeutic applications.

CONTACT US

USA

Tel:

Fax:

Email:

Stay Up To Date
Subscribe

© 2022 Creative Biolabs All Rights Reserved